PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG000304t1
Common NameTCM_000304
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 164aa    MW: 18605.7 Da    PI: 6.8989
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG000304t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1391.7e-123289562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                      k+ +rk +NRe+ArrsR RK++ ++ L   v +L++ N +    ++  ++++ ++++e
  Thecc1EG000304t1 32 KKRKRKLSNRESARRSRIRKQKHLDDLMGQVSQLTKDNNQILTSMNITTQLYLNVEAE 89
                      899***********************************99888877777777766666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-162892IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.2663077IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-1030106No hitNo description
SuperFamilySSF579591.13E-113284No hitNo description
PfamPF001704.1E-103273IPR004827Basic-leucine zipper domain
CDDcd147028.23E-173383No hitNo description
PROSITE patternPS0003603550IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MATSSTGASS ASSTMMRSSS TDENLQQILD EKKRKRKLSN RESARRSRIR KQKHLDDLMG  60
QVSQLTKDNN QILTSMNITT QLYLNVEAEN SVLRAQMTEL STRLQSLYEI IDFINSSNGV  120
FENDHNFEAA HHHHQINDDT FINPWTSFSV NQHVMASADM IMN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13037EKKRKRKL
23136KKRKRK
34451RRSRIRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046830.11e-117Basic leucine-zipper 44, putative
TrEMBLA0A061DFY41e-117A0A061DFY4_THECC; Basic leucine-zipper 44, putative
STRINGPOPTR_0005s25290.12e-57(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.15e-41basic leucine-zipper 2
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]